Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD67/GAD1 Rabbit pAb (APR25028N)

Product Specifications

Background

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GAD67/GAD1 Rabbit pAb (APR25028N) .

Synonyms

GAD1; CPSQ1; GAD; SCP

Gene ID

2571

UniProt

Q99259

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/47kDa/66kDa Observed MW: 67KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2571

Uniprot URL

https://www.uniprot.org/uniprot/Q99259

AA Sequence

MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MIR649 qPCR Primer Pair
QH81713S 200 Tests

Human MIR649 qPCR Primer Pair

Sign In for Pricing
View Details
ABHD14A Protein Vector (Mouse) (pPM-C-HA)
PV151272 500 ng

ABHD14A Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
50 - 1200 µl, 8-channel pipette, Variable volume
AE-8-1200 1 Piece

50 - 1200 µl, 8-channel pipette, Variable volume

Sign In for Pricing
View Details
Mouse Monoclonal ZAP70 Antibody (ZAP70/528 + 2F3.2) [Alexa Fluor 700]
NBP2-47775AF700 0.1 mL

Mouse Monoclonal ZAP70 Antibody (ZAP70/528 + 2F3.2) [Alexa Fluor 700]

Sign In for Pricing
View Details
Mrgpra2 (BC064040) Mouse Untagged Clone
MC206660 10 µg

Mrgpra2 (BC064040) Mouse Untagged Clone

Sign In for Pricing
View Details
Lentiviral human PLSCR5 shRNA (UAS) - Lentiviral human PLSCR5 shRNA (UAS, GFP) (25)
GTR15116672 1 Vial

Lentiviral human PLSCR5 shRNA (UAS) - Lentiviral human PLSCR5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details