Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GAD67/GAD1 Rabbit pAb (APR25028N)

Product Specifications

Background

This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantigen and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Deficiency in this enzyme has been shown to lead to pyridoxine dependency with seizures. Alternative splicing of this gene results in two products, the predominant 67-kD form and a less-frequent 25-kD form.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GAD67/GAD1 Rabbit pAb (APR25028N) .

Synonyms

GAD1; CPSQ1; GAD; SCP

Gene ID

2571

UniProt

Q99259

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 25kDa/47kDa/66kDa Observed MW: 67KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2571

Uniprot URL

https://www.uniprot.org/uniprot/Q99259

AA Sequence

MASSTPSSSATSSNAGADPNTTNLRPTTYDTWCGVAHGCTRKLGLKICGFLQRTNSLEEKSRLVSAFKERQSSKNLLSCENSDRDARFRRTETDFSNLFARDLLPAKNGEEQTVQFLLEVVDILLNYVRKTFDRSTKVLDFHHPHQLLEGMEGFNLELSDHPESLEQILVDCRDTLKYGVRTGHPRFFNQLSTGLDIIGL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL10 Antibody, HRP conjugated
A61964-100UG 100 µg

CXCL10 Antibody, HRP conjugated

Sign In for Pricing
View Details
Recombinant Human gamma C Crystallin Protein
NBP1-98998-100ug 100 µg

Recombinant Human gamma C Crystallin Protein

Sign In for Pricing
View Details
Human Elastin (ELN) ELISA Kit
RD-ELN-Hu-01 96 Tests

Human Elastin (ELN) ELISA Kit

Sign In for Pricing
View Details
Human Elastin (ELN) ELISA Kit
RD-ELN-Hu-02 48 Tests

Human Elastin (ELN) ELISA Kit

Sign In for Pricing
View Details
Human MYO1A Pre-designed siRNA Set A
SI010144A 1 Each

Human MYO1A Pre-designed siRNA Set A

Sign In for Pricing
View Details
Coa8 Mouse siRNA Oligo Duplex (Locus ID 68020)
SR404806 1 Kit

Coa8 Mouse siRNA Oligo Duplex (Locus ID 68020)

Sign In for Pricing
View Details