Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GABRR1 Rabbit pAb (APR25027N)

Product Specifications

Background

GABA is the major inhibitory neurotransmitter in the mammalian brain where it acts at GABA receptors, which are ligand-gated chloride channels. GABRR1 is a member of the rho subunit family. Several transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality GABRR1 Rabbit pAb (APR25027N) .

Synonyms

GABRR1

Gene ID

2569

UniProt

P24046

Cellular Locus

Cell junction, Cell membrane, Multi-pass membrane protein, postsynaptic cell membrane, synapse

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 45kDa/53kDa/55kDa Observed MW: 56kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2569

Uniprot URL

https://www.uniprot.org/uniprot/P24046

AA Sequence

MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPILRRSPDITKSPLTKSEQLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-EL-M1801-01 24 Tests

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-EL-M1801-02 48 Tests

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit
E-EL-M1801-03 96 Tests

Mouse cTnT/TNNT2 (Troponin T Type 2, Cardiac) ELISA Kit

Sign In for Pricing
View Details
11-Ethoxycarbonyldodecanoic Acid
TRC-E890455-500MG 500 mg

11-Ethoxycarbonyldodecanoic Acid

Sign In for Pricing
View Details
Poly-L-lysine Coated - 96 well Solid plates - Black PS
MCB12F-LYS-L 10x 96 Well Plates

Poly-L-lysine Coated - 96 well Solid plates - Black PS

Sign In for Pricing
View Details
p75 NGF Receptor Recombinant Rabbit Monoclonal Antibody [SA39-02]
ET1601-22 100 µL

p75 NGF Receptor Recombinant Rabbit Monoclonal Antibody [SA39-02]

Sign In for Pricing
View Details