Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4G2 Rabbit pAb (APR25005N)

Product Specifications

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4G2 Rabbit pAb (APR25005N) .

Synonyms

EIF4G2; AAG1; DAP5; NAT1; P97

Gene ID

1982

UniProt

P78344

Dilution

WB 1:500 - 1:1000 IHC 1:100 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa/102kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1982

Uniprot URL

https://www.uniprot.org/uniprot/P78344

AA Sequence

IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DR4 (TNFRSF10A) (NM_003844) Human Tagged ORF Clone
RG202152 10 µg

DR4 (TNFRSF10A) (NM_003844) Human Tagged ORF Clone

Sign In for Pricing
View Details
ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (MaxLight 405) discontinued
126279-ML405 100 µL

ELF4 (ETS-related Transcription Factor Elf-4, E74-like Factor 4, Myeloid Elf-1-like Factor, MEF, ELFR) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Borrelia Garinii rpsK Protein (aa 1-130)
VAng-Lsx2103-500gEcoli 500 µg (E. coli)

Recombinant Borrelia Garinii rpsK Protein (aa 1-130)

Sign In for Pricing
View Details
ZNF324 Protein Vector (Human) (pPB-C-His)
PV047669 500 ng

ZNF324 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Recombinant human PIVKA-II/DCP
A10H10 1 Each

Recombinant human PIVKA-II/DCP

Sign In for Pricing
View Details
Anti-NQO1 antibody
STJ94551 200 µl

Anti-NQO1 antibody

Sign In for Pricing
View Details