Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4G2 Rabbit pAb (APR25005N)

Product Specifications

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality EIF4G2 Rabbit pAb (APR25005N) .

Synonyms

EIF4G2; AAG1; DAP5; NAT1; P97

Gene ID

1982

UniProt

P78344

Dilution

WB 1:500 - 1:1000 IHC 1:100 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 98kDa/102kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1982

Uniprot URL

https://www.uniprot.org/uniprot/P78344

AA Sequence

IYKWIKDNISPKLHVDKGFVNILMTSFLQYISSEVNPPSDETDSSSAPSKEQLEQEKQLLLSFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ces1a (m) -PR
sc-143395-PR 10 µM - 20 µL

Ces1a (m) -PR

Sign In for Pricing
View Details
Sheep Nephrin ELISA Kit
ESN0086 96 Tests

Sheep Nephrin ELISA Kit

Sign In for Pricing
View Details
Guinea pig ankyrin ELISA Kit
EIA05262Gu 1 Kit

Guinea pig ankyrin ELISA Kit

Sign In for Pricing
View Details
anti-EIF3G
YF-PA15779 50 ug

anti-EIF3G

Sign In for Pricing
View Details
Anti-Human SLC30A10 Polyclonal Antibody
PHP15501 100 μg

Anti-Human SLC30A10 Polyclonal Antibody

Sign In for Pricing
View Details
Human COA3 Knockout A549 cell line
GTR15406180 1 Vial

Human COA3 Knockout A549 cell line

Sign In for Pricing
View Details