Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BDKRB2 Rabbit pAb (APR24977N)

Product Specifications

Background

This gene encodes a receptor for bradykinin. The 9 aa bradykinin peptide elicits many responses including vasodilation, edema, smooth muscle spasm and pain fiber stimulation. This receptor associates with G proteins that stimulate a phosphatidylinositol-calcium second messenger system. Alternate start codons result in two isoforms of the protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BDKRB2 Rabbit pAb (APR24977N) .

Synonyms

BDKRB2; B2R; BK-2; BK2; BKR2; BRB2

Gene ID

624

UniProt

P30411

Cellular Locus

Cell membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/44kDa Observed MW: 44kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=624

Uniprot URL

https://www.uniprot.org/uniprot/P30411

AA Sequence

SSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEPIQMENSMGTLRTSISVERQIHKLQDWAGSRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBASH3A-Specific antibody
FNab09150 100 µg

UBASH3A-Specific antibody

Sign In for Pricing
View Details
Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL
BNC941992-100 1x 100 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1992), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Fluorobenzyl Bromide
TRC-F588605-5G 5 g

3-Fluorobenzyl Bromide

Sign In for Pricing
View Details
SOBP (C-term) Rabbit Polyclonal Antibody
AP53980PU-N 400 µL

SOBP (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse PSA (Prostate Specific Antigen) ELISA Kit
E-EL-M0961-01 24 Tests

Mouse PSA (Prostate Specific Antigen) ELISA Kit

Sign In for Pricing
View Details
Mouse PSA (Prostate Specific Antigen) ELISA Kit
E-EL-M0961-02 48 Tests

Mouse PSA (Prostate Specific Antigen) ELISA Kit

Sign In for Pricing
View Details