Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX6B1 Rabbit pAb (APR24896N)

Product Specifications

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality COX6B1 Rabbit pAb (APR24896N) .

Synonyms

COX6B1; COX6B; COXG; COXVIb1

Gene ID

1340

UniProt

P14854

Cellular Locus

Mitochondrion intermembrane space

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 10kDa Observed MW: 13kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1340

Uniprot URL

https://www.uniprot.org/uniprot/P14854

AA Sequence

MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DEFB4A, N-GST
MBS1572534-01 0.1 mg

Recombinant Human DEFB4A, N-GST

Sign In for Pricing
View Details
Recombinant Human DEFB4A, N-GST
MBS1572534-02 1 mg

Recombinant Human DEFB4A, N-GST

Sign In for Pricing
View Details
Recombinant Human DEFB4A, N-GST
MBS1572534-03 5x 1 mg

Recombinant Human DEFB4A, N-GST

Sign In for Pricing
View Details
SHMT2 Rabbit Polyclonal Antibody
orb579686 100 µL

SHMT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rat Scn9a / Sodium channel protein type 9 subunit alpha Recombinant Protein
R15345r 1 Each

Rat Scn9a / Sodium channel protein type 9 subunit alpha Recombinant Protein

Sign In for Pricing
View Details
Atp6v0a4 (NM_080467) Mouse Tagged ORF Clone Lentiviral Particle
MR210875L4V 200 µL

Atp6v0a4 (NM_080467) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details