Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPKBP1 Rabbit pAb (APR24889N)

Product Specifications

Background

This gene encodes a scaffold protein that regulates the JNK (c-Jun N-terminal kinase) and NOD2 (nucleotide-binding oligomerization domain-containing protein 2) signaling pathways. The encoded protein interacts with another related JNK pathway scaffold protein, WDR62, via a conserved dimerization domain, and enhances JNK signaling. This protein may play a role in bacterial immunity by binding to the NOD2 receptor and negatively regulating downstream antibacterial and pro-inflammatory signaling. Mutations in this gene that impair cellular localization of the encoded protein cause a form of nephronophthisis, an autosomal-recessive kidney disorder, in human patients.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAPKBP1 Rabbit pAb (APR24889N) .

Synonyms

MAPKBP1; JNKBP-1; JNKBP1; NPHP20

Gene ID

23005

UniProt

O60336

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 23kDa/109kDa/134kDa/149kDa/163kDa Observed MW: 164kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=23005

Uniprot URL

https://www.uniprot.org/uniprot/O60336

AA Sequence

MAVEGSTITSRIKNLLRSPSIKLRRSKAGNRREDLSSKVTLEKVLGITVSGGRGLACDPRSGLVAYPAGCVVVLFNPRKHKQHHILNSSRKTITALAFSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 405)
MBS6195634-01 0.1 mL

FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 405)

Sign In for Pricing
View Details
FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 405)
MBS6195634-02 5x 0.1 mL

FRZB (frizzled-Related Protein, FRE, FRITZ, FRP-3, FRZB-1, FRZB-PEN, FRZB1, FZRB, SFRP3, SRFP3, hFIZ) (MaxLight 405)

Sign In for Pricing
View Details
Lamellipodin (A-8) : m-IgG1 BP-HRP Bundle
sc-542329 1 Kit

Lamellipodin (A-8) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details
ADAM15 Protein (C-His, Human)
P513023 100 µg

ADAM15 Protein (C-His, Human)

Sign In for Pricing
View Details
Rat apelin 12 (AP12) Elisa Kit
EK720253 96 Well

Rat apelin 12 (AP12) Elisa Kit

Sign In for Pricing
View Details
Bisphenol A Bissulfate Disodium Salt-13C12
162902 2.5 mg

Bisphenol A Bissulfate Disodium Salt-13C12

Sign In for Pricing
View Details