Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPRE1 Rabbit pAb (APR24887N)

Product Specifications

Background

The protein encoded by this gene was first identified by its binding to the APC protein which is often mutated in familial and sporadic forms of colorectal cancer. This protein localizes to microtubules, especially the growing ends, in interphase cells. During mitosis, the protein is associated with the centrosomes and spindle microtubules. The protein also associates with components of the dynactin complex and the intermediate chain of cytoplasmic dynein. Because of these associations, it is thought that this protein is involved in the regulation of microtubule structures and chromosome stability. This gene is a member of the RP/EB family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MAPRE1 Rabbit pAb (APR24887N) .

Synonyms

MAPRE1; EB1

Gene ID

22919

UniProt

Q15691

Cellular Locus

Cytoplasm, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa Observed MW: 34kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=22919

Uniprot URL

https://www.uniprot.org/uniprot/Q15691

AA Sequence

ETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVVRKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQENEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERCC6 Antibody
CSB-PA008134-01 50 µg

ERCC6 Antibody

Sign In for Pricing
View Details
ERCC6 Antibody
CSB-PA008134-02 100 µg

ERCC6 Antibody

Sign In for Pricing
View Details
KDM4D (Lysine-specific Demethylase 4D, Lysine (K) -specific Demethylase 4D
484110 100 µL

KDM4D (Lysine-specific Demethylase 4D, Lysine (K) -specific Demethylase 4D

Sign In for Pricing
View Details
Polyclonal RNF35 / TRIM40 Antibody (C-Term)
APG00402G 0.1mg

Polyclonal RNF35 / TRIM40 Antibody (C-Term)

Sign In for Pricing
View Details
POFUT2 Antibody, Biotin conjugated
CSB-PA837737LD01HU-01 50 µg

POFUT2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
POFUT2 Antibody, Biotin conjugated
CSB-PA837737LD01HU-02 100 µg

POFUT2 Antibody, Biotin conjugated

Sign In for Pricing
View Details