Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CEACAM3 Rabbit pAb (APR24872N)

Product Specifications

Background

This gene encodes a member of the family of carcinoembryonic antigen-related cell adhesion molecules (CEACAMs), which are used by several bacterial pathogens to bind and invade host cells. The encoded transmembrane protein directs phagocytosis of several bacterial species that is dependent on the small GTPase Rac. It is thought to serve an important role in controlling human-specific pathogens by the innate immune system. Alternatively spliced transcript variants have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CEACAM3 Rabbit pAb (APR24872N) .

Synonyms

CEACAM3; CD66D; CEA; CGM1; W264; W282

Gene ID

1084

UniProt

P40198

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 19kDa/22kDa/27kDa Observed MW: 38kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1084

Uniprot URL

https://www.uniprot.org/uniprot/P40198

AA Sequence

MGPPSASPHRECIPWQGLLLTASLLNFWNPPTTAKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Reactive Protein Antibody
KC-6044-01 50 μL

C-Reactive Protein Antibody

Sign In for Pricing
View Details
C-Reactive Protein Antibody
KC-6044-02 100 µL

C-Reactive Protein Antibody

Sign In for Pricing
View Details
C-Reactive Protein Antibody
KC-6044-03 1 mL

C-Reactive Protein Antibody

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
E-EL-H6279-01 24 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
E-EL-H6279-02 48 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details
Human LDL (Low Density Lipoprotein) ELISA Kit
E-EL-H6279-03 96 Tests

Human LDL (Low Density Lipoprotein) ELISA Kit

Sign In for Pricing
View Details