Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] APEX1/APE1 Rabbit pAb (APR24870N)

Product Specifications

Background

Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] APEX1/APE1 Rabbit pAb (APR24870N) .

Synonyms

APEX1; APE; APE1; APEN; APEX; APX; HAP1; REF1

Gene ID

328

UniProt

P27695

Cellular Locus

Cytoplasm, Endoplasmic reticulum, Mitochondrion, Nucleus, Nucleus speckle, nucleolus

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:100 IP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa Observed MW: 39kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=328

Uniprot URL

https://www.uniprot.org/uniprot/P27695

AA Sequence

MPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGDEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARL8A shRNA Plasmid (h)
sc-88429-SH 20 µg

ARL8A shRNA Plasmid (h)

Sign In for Pricing
View Details
Porcine Pro Atrial Natriuretic Peptide 1-98 (Pro-ANP 1-98) ELISA Kit
NSL0208Po 96 Tests

Porcine Pro Atrial Natriuretic Peptide 1-98 (Pro-ANP 1-98) ELISA Kit

Sign In for Pricing
View Details
Nasp Rat Pre-designed siRNA Set A
HY-RS26811 1 Set

Nasp Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
EpCAM, CT (EPCAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1, Epithelial cell adhesion molecule, Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, KS
MBS6295917-01 0.1 mL

EpCAM, CT (EPCAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1, Epithelial cell adhesion molecule, Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, KS

Sign In for Pricing
View Details
EpCAM, CT (EPCAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1, Epithelial cell adhesion molecule, Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, KS
MBS6295917-02 5x 0.1 mL

EpCAM, CT (EPCAM, GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1, Epithelial cell adhesion molecule, Adenocarcinoma-associated antigen, Cell surface glycoprotein Trop-1, Epithelial cell surface antigen, Epithelial glycoprotein, Epithelial glycoprotein 314, KS

Sign In for Pricing
View Details
Phospho-GSK3beta (Ser9) Mouse Monoclonal Antibody (6H9)
MBS8596867-01 0.1 mg

Phospho-GSK3beta (Ser9) Mouse Monoclonal Antibody (6H9)

Sign In for Pricing
View Details