Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytokeratin 7 (KRT7) Rabbit pAb (APR24857N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cytokeratin 7 (KRT7) Rabbit pAb (APR24857N) .

Synonyms

KRT7; CK7; K2C7; K7; SCL; keratin 7; Keratin

Gene ID

3855

UniProt

P08729

Cellular Locus

Cytoplasm

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa Observed MW: 51kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3855

Uniprot URL

https://www.uniprot.org/uniprot/P08729

AA Sequence

ETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SFRS9 Antibody (OTI5G7) [Biotin]
NBP2-74152B 0.1 mL

Mouse Monoclonal SFRS9 Antibody (OTI5G7) [Biotin]

Sign In for Pricing
View Details
Sunlong Medical™ Human TRAIL/TNFSF10 ELISA Kit
EL0206Hu-01 48 Tests

Sunlong Medical™ Human TRAIL/TNFSF10 ELISA Kit

Sign In for Pricing
View Details
Sunlong Medical™ Human TRAIL/TNFSF10 ELISA Kit
EL0206Hu-02 96 Tests

Sunlong Medical™ Human TRAIL/TNFSF10 ELISA Kit

Sign In for Pricing
View Details
Standard rack (HxD) 4x3=12 boxes, 40mm, 171x422x139mm, B10
TE23010B10 1 Piece

Standard rack (HxD) 4x3=12 boxes, 40mm, 171x422x139mm, B10

Sign In for Pricing
View Details
Entpd4 Mouse qPCR Primer Pair (NM_026174)
MP204078 200 Reactions

Entpd4 Mouse qPCR Primer Pair (NM_026174)

Sign In for Pricing
View Details
iFluor™ 647 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]
HA720149F 100 µL

iFluor™ 647 Conjugated Cytokeratin 16 Recombinant Rabbit Monoclonal Antibody [SC52-09]

Sign In for Pricing
View Details