Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Cytokeratin 7 (KRT7) Rabbit pAb (APR24857N)

Product Specifications

Background

The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the simple epithelia lining the cavities of the internal organs and in the gland ducts and blood vessels. The genes encoding the type II cytokeratins are clustered in a region of chromosome 12q12-q13. Alternative splicing may result in several transcript variants; however, not all variants have been fully described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Cytokeratin 7 (KRT7) Rabbit pAb (APR24857N) .

Synonyms

KRT7; CK7; K2C7; K7; SCL; keratin 7; Keratin

Gene ID

3855

UniProt

P08729

Cellular Locus

Cytoplasm

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 51kDa Observed MW: 51kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3855

Uniprot URL

https://www.uniprot.org/uniprot/P08729

AA Sequence

ETELTELQSQISDTSVVLSMDNSRSLDLDGIIAEVKAQYEEMAKCSRAEAEAWYQTKFETLQAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASASRRSARD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Cynomolgus Monkey ATL1 Protein, His (Fc)-Avi-tagged
ATL1-69C 50 µg

Recombinant Cynomolgus Monkey ATL1 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Nucleosome ChIP Sonication Buffer
10450076-2 250 mL

Nucleosome ChIP Sonication Buffer

Sign In for Pricing
View Details
Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)
MBS1013108-01 0.02 mg (E-Coli)

Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)

Sign In for Pricing
View Details
Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)
MBS1013108-02 0.02 mg (Yeast)

Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)

Sign In for Pricing
View Details
Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)
MBS1013108-03 0.1 mg (E-Coli)

Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)

Sign In for Pricing
View Details
Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)
MBS1013108-04 0.1 mg (Yeast)

Recombinant Arthroderma benhamiae Probable leucine aminopeptidase ARB_03492 (ARB_03492)

Sign In for Pricing
View Details