Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKG1 Rabbit pAb (APR24848N)

Product Specifications

Background

Mammals have three different isoforms of cyclic GMP-dependent protein kinase (Ialpha, Ibeta, and II) . These PRKG isoforms act as key mediators of the nitric oxide/cGMP signaling pathway and are important components of many signal transduction processes in diverse cell types. This PRKG1 gene on human chromosome 10 encodes the soluble Ialpha and Ibeta isoforms of PRKG by alternative transcript splicing. A separate gene on human chromosome 4, PRKG2, encodes the membrane-bound PRKG isoform II. The PRKG1 proteins play a central role in regulating cardiovascular and neuronal functions in addition to relaxing smooth muscle tone, preventing platelet aggregation, and modulating cell growth. This gene is most strongly expressed in all types of smooth muscle, platelets, cerebellar Purkinje cells, hippocampal neurons, and the lateral amygdala. Isoforms Ialpha and Ibeta have identical cGMP-binding and catalytic domains but differ in their leucine/isoleucine zipper and autoinhibitory sequences and therefore differ in their dimerization substrates and kinase enzyme activity.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PRKG1 Rabbit pAb (APR24848N) .

Synonyms

PRKG1; AAT8; PKG; PRKG1B; PRKGR1B; cGK; cGK 1; cGK1; cGKI; cGKI-BETA; cGKI-alpha

Gene ID

5592

UniProt

Q13976

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 44kDa/76kDa/77kDa Observed MW: 65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5592

Uniprot URL

https://www.uniprot.org/uniprot/Q13976

AA Sequence

MGTLRDLQYALQEKIEELRQRDALIDELELELDQKDELIQKLQNELDKYRSVIRPATQQAQKQSASTLQGEPRTKRQAISAEPTAFDIQDLSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPEEILSKLADVLEETHYENGEYIIRQGARGDTFFIISKGTVNVTREDSPSEDPVFLRTLG

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Human GPR84 Protein, hFc Tag
E33P101470 10 µg

Human GPR84 Protein, hFc Tag

Ask
View Details
Dlx-3 Polyclonal Antibody
ABP51177-01 30 µL

Dlx-3 Polyclonal Antibody

Ask
View Details
Dlx-3 Polyclonal Antibody
ABP51177-02 100 µL

Dlx-3 Polyclonal Antibody

Ask
View Details
Dlx-3 Polyclonal Antibody
ABP51177-03 200 µL

Dlx-3 Polyclonal Antibody

Ask
View Details
TRIM68 (E3 Ubiquitin-protein Ligase TRIM68, RING Finger Protein 137, SSA Protein SS-56, SS-56, Tripartite Motif-containing Protein 68, GC109, RNF137, SS56) (MaxLight 650)
MBS6225218-01 0.1 mL

TRIM68 (E3 Ubiquitin-protein Ligase TRIM68, RING Finger Protein 137, SSA Protein SS-56, SS-56, Tripartite Motif-containing Protein 68, GC109, RNF137, SS56) (MaxLight 650)

Ask
View Details
TRIM68 (E3 Ubiquitin-protein Ligase TRIM68, RING Finger Protein 137, SSA Protein SS-56, SS-56, Tripartite Motif-containing Protein 68, GC109, RNF137, SS56) (MaxLight 650)
MBS6225218-02 5x 0.1 mL

TRIM68 (E3 Ubiquitin-protein Ligase TRIM68, RING Finger Protein 137, SSA Protein SS-56, SS-56, Tripartite Motif-containing Protein 68, GC109, RNF137, SS56) (MaxLight 650)

Ask
View Details