Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

14-3-3 Theta Rabbit pAb (APR24846N)

Product Specifications

Background

This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse and rat orthologs. This gene is upregulated in patients with amyotrophic lateral sclerosis. It contains in its 5' UTR a 6 bp tandem repeat sequence which is polymorphic, however, there is no correlation between the repeat number and the disease.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality 14-3-3 Theta Rabbit pAb (APR24846N) .

Synonyms

YWHAQ; 14-3-3; 1C5; HS1

Gene ID

10971

UniProt

P27348

Cellular Locus

Cytoplasm

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 27kDa Observed MW: 32kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10971

Uniprot URL

https://www.uniprot.org/uniprot/P27348

AA Sequence

MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIDNSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEGAEN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-01 0.02 mg (E-Coli)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-02 0.02 mg (Yeast)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-03 0.1 mg (E-Coli)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-04 0.1 mg (Yeast)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-05 0.02 mg (Baculovirus)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details
Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A
MBS1084826-06 0.02 mg (Mammalian-Cell)

Recombinant Serratia proteamaculans Na (+)-translocating NADH-quinone reductase subunit A

Sign In for Pricing
View Details