Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRF2 Rabbit pAb (APR24842N)

Product Specifications

Background

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IRF2 Rabbit pAb (APR24842N) .

Synonyms

IRF2; IRF-2

Gene ID

3660

UniProt

P14316

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 45KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3660

Uniprot URL

https://www.uniprot.org/uniprot/P14316

AA Sequence

KKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMB Substrate (3D-IF)
85R-121 60 ml

TMB Substrate (3D-IF)

Sign In for Pricing
View Details
TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 550)
MBS6358788-01 0.1 mL

TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 550)

Sign In for Pricing
View Details
TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 550)
MBS6358788-02 5x 0.1 mL

TROVE2, CT (TROVE2, RO60, SSA2, 60kD SS-A/Ro ribonucleoprotein, Ro 60kD autoantigen, Sjoegren syndrome antigen A2, Sjoegren syndrome type A antigen, TROVE domain family member 2) (MaxLight 550)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG2a-HRP
1081-05 1.0 mL

Goat Anti-Mouse IgG2a-HRP

Sign In for Pricing
View Details
COQ7 siRNA (h)
sc-62146 10 µM

COQ7 siRNA (h)

Sign In for Pricing
View Details
RNU7-68P-set siRNA/shRNA/RNAi Lentivector (Human)
40581091 4x 500 ng

RNU7-68P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details