Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Integrin beta 3 (ITGB3/CD61) Rabbit pAb (APR24826N)

Product Specifications

Background

The ITGB3 protein product is the integrin beta chain beta 3. Integrins are integral cell-surface proteins composed of an alpha chain and a beta chain. A given chain may combine with multiple partners resulting in different integrins. Integrin beta 3 is found along with the alpha IIb chain in platelets. Integrins are known to participate in cell adhesion as well as cell-surface mediated signalling.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Integrin beta 3 (ITGB3/CD61) Rabbit pAb (APR24826N) .

Synonyms

BDPLT16; BDPLT2; CD61; GP3A; GPIIIa; GT; Integrin beta 3; ITGB3

Gene ID

3690

UniProt

P05106

Cellular Locus

Cell junction, Cell membrane, Cell projection, Single-pass type I membrane protein, focal adhesion, lamellipodium membrane

Applications

WB (Gallus gallus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 86kDa/87kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3690

Uniprot URL

https://www.uniprot.org/uniprot/P05106

AA Sequence

GSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRYCRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thyroxine (T4) (MaxLight 405)
MBS6263668-01 0.1 mL

Thyroxine (T4) (MaxLight 405)

Sign In for Pricing
View Details
Thyroxine (T4) (MaxLight 405)
MBS6263668-02 5x 0.1 mL

Thyroxine (T4) (MaxLight 405)

Sign In for Pricing
View Details
ANGPTL1 (Biotin)
555059-01 50 µg

ANGPTL1 (Biotin)

Sign In for Pricing
View Details
ANGPTL1 (Biotin)
555059-02 100 µg

ANGPTL1 (Biotin)

Sign In for Pricing
View Details
MeCP2 Peptide
AF6656-BP 1 mg

MeCP2 Peptide

Sign In for Pricing
View Details
Mouse monoclonal Anti-TAL1 Clone 2TL75
TA353480L 500 µg

Mouse monoclonal Anti-TAL1 Clone 2TL75

Sign In for Pricing
View Details