Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF5 Rabbit pAb (APR24823N)

Product Specifications

Background

The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRAF5 Rabbit pAb (APR24823N) .

Synonyms

TRAF5; MGC:39780; RNF84

Gene ID

7188

UniProt

O00463

Cellular Locus

Cytoplasm, cytosol

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/64kDa/65kDa Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7188

Uniprot URL

https://www.uniprot.org/uniprot/O00463

AA Sequence

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hsf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
23960116 3x 1.0 µg

Hsf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral mouse Tsen2 shRNA (UAS) - Lentiviral mouse Tsen2 shRNA (UAS, GFP) (100)
GTR15294156 1 Vial

Lentiviral mouse Tsen2 shRNA (UAS) - Lentiviral mouse Tsen2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Anti-Ki-67 Antibody
C-1807-50 50 μL

Anti-Ki-67 Antibody

Sign In for Pricing
View Details
(4- (3-chloro-6-methylphenyl) piperazinyl) -N- (4-methylphenyl) formamide
VKB88588 250 mg

(4- (3-chloro-6-methylphenyl) piperazinyl) -N- (4-methylphenyl) formamide

Sign In for Pricing
View Details
Lentiviral human GLYAT shRNA (UAS) - Lentiviral human GLYAT shRNA (UAS, iRFP) (25)
GTR15092246 1 Vial

Lentiviral human GLYAT shRNA (UAS) - Lentiviral human GLYAT shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
CASQ1 Antibody
46407 100 µL

CASQ1 Antibody

Sign In for Pricing
View Details