Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRAF5 Rabbit pAb (APR24823N)

Product Specifications

Background

The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TRAF5 Rabbit pAb (APR24823N) .

Synonyms

TRAF5; MGC:39780; RNF84

Gene ID

7188

UniProt

O00463

Cellular Locus

Cytoplasm, cytosol

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 52kDa/64kDa/65kDa Observed MW: 64kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7188

Uniprot URL

https://www.uniprot.org/uniprot/O00463

AA Sequence

MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H10 (h) -PR
sc-62460-PR 10 µM - 20 µL

Histone H10 (h) -PR

Sign In for Pricing
View Details
RBPMS2-set siRNA/shRNA/RNAi Lentivector (Human)
38720091 4x 500 ng

RBPMS2-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Cleaved-CTSG (I21) Antibody
A10657-100UG 100 µg

Cleaved-CTSG (I21) Antibody

Sign In for Pricing
View Details
PLA2G10 (NM_003561) Human Tagged ORF Clone Lentiviral Particle
RC213014L1V 200 µL

PLA2G10 (NM_003561) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
URB1 Protein Lysate (Human) with C-Ha Tag
49245031 100 µg

URB1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS544940 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details