Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNK2 Rabbit pAb (APR24813N)

Product Specifications

Background

This gene encodes a tyrosine kinase that binds Cdc42Hs in its GTP-bound form and inhibits both the intrinsic and GTPase-activating protein (GAP) -stimulated GTPase activity of Cdc42Hs. This binding is mediated by a unique sequence of 47 amino acids C-terminal to an SH3 domain. The protein may be involved in a regulatory mechanism that sustains the GTP-bound active form of Cdc42Hs and which is directly linked to a tyrosine phosphorylation signal transduction pathway. Several alternatively spliced transcript variants have been identified from this gene, but the full-length nature of only two transcript variants has been determined.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TNK2 Rabbit pAb (APR24813N) .

Synonyms

TNK2; ACK; ACK-1; ACK1; p21cdc42Hs

Gene ID

10188

UniProt

Q07912

Cellular Locus

Cell junction, Cell membrane, Cytoplasmic side, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endosome, Membrane, Nucleus, Peripheral membrane protein, adherens junction, clathrin-coated pit, clathrin-coated vesicle

Applications

WB (Drosophila)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 60kDa/114kDa/119kDa Observed MW: 115kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10188

Uniprot URL

https://www.uniprot.org/uniprot/Q07912

AA Sequence

TGWLLELLSEVQLQQYFLRLRDDLNVTRLSHFEYVKNEDLEKIGMGRPGQRRLWEAVKRRKALCKRKSWMSKVFSGKRLEAEFPPHHSQSTFRKTSPAPGGPAGEGPLQSLTCLIGEKDLRLLEKLGDGSFGVVRRGEWDAPSGKTVSVAVKCLKPDVLSQPEAMDDFIREVNAMHSLDHRNLIRLYGVVLTPPMKMVTELAPLGSLLDRLRKHQGHFLLGTLSRYAVQVAEGMGYLESKRFIHRDLAARNLLLATRDLVKIGDFGLMRALPQNDDHYVMQEHRKVPFAWCAPESLKTRTFSHASDTWMFGVTLWE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Uterus
CS509979 5x 5 µm

Frozen Tissue Sections, Uterus

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UM1-01 25 µg

Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]
E-AB-F1094UM1-02 100 µg

Elab Fluor® 700 Anti-Mouse CD90.2/Thy1.2 Antibody[30H12]

Sign In for Pricing
View Details
2-(Di-tert-butylphosphino)-1,1'-binaphthyl 98% TrixiePhos
TRC-D493766-250MG 250 mg

2-(Di-tert-butylphosphino)-1,1'-binaphthyl 98% TrixiePhos

Sign In for Pricing
View Details
TTLL12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H3]
TA500780AM 100 µL

TTLL12 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H3]

Sign In for Pricing
View Details
Human ZSCAN5 (ZSCAN5A) activation kit by CRISPRa
GA112386 1 Kit

Human ZSCAN5 (ZSCAN5A) activation kit by CRISPRa

Sign In for Pricing
View Details