Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSMA1 Rabbit pAb (APR24810N)

Product Specifications

Background

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PSMA1 Rabbit pAb (APR24810N) .

Synonyms

PSMA1; HC2; HEL-S-275; NU; PROS30

Gene ID

5682

UniProt

P25786

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IF 1:10 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 29kDa/30kDa Observed MW: 30kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5682

Uniprot URL

https://www.uniprot.org/uniprot/P25786

AA Sequence

MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQKKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPTQRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFMECNLNELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLEGLEERPQRKAQPAQPADEPAEKADEPMEH

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Blood Group Kp(bc) (Kell Antigen, CD238, CD238 Antigen, ECE3, Kel, Kell Blood Group Glycoprotein, Kell Blood Group Metallo-endopeptidase, Kell Protein)
MBS633483-01 0.2 mg

Blood Group Kp(bc) (Kell Antigen, CD238, CD238 Antigen, ECE3, Kel, Kell Blood Group Glycoprotein, Kell Blood Group Metallo-endopeptidase, Kell Protein)

Ask
View Details
Blood Group Kp(bc) (Kell Antigen, CD238, CD238 Antigen, ECE3, Kel, Kell Blood Group Glycoprotein, Kell Blood Group Metallo-endopeptidase, Kell Protein)
MBS633483-02 5x 0.2 mg

Blood Group Kp(bc) (Kell Antigen, CD238, CD238 Antigen, ECE3, Kel, Kell Blood Group Glycoprotein, Kell Blood Group Metallo-endopeptidase, Kell Protein)

Ask
View Details
Mouse Monoclonal VEGFR1/Flt-1 Antibody (EWF) [mFluor Violet 500 SE]
NB600-1006MFV500 0.1 mL

Mouse Monoclonal VEGFR1/Flt-1 Antibody (EWF) [mFluor Violet 500 SE]

Ask
View Details
CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 490)
244502-ML490 100 µL

CDH2 (Cadherin 2, Type 1, N-Cadherin (Neuronal), CD325, CDHN, CDw325, NCAD) (MaxLight 490)

Ask
View Details
Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody
NBP1-72699 2 mg

Donkey Polyclonal Donkey anti-Sheep IgG (H+L) Secondary Antibody

Ask
View Details