Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WNT1 Rabbit pAb (APR24778N)

Product Specifications

Background

The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is very conserved in evolution, and the protein encoded by this gene is known to be 98% identical to the mouse Wnt1 protein at the amino acid level. The studies in mouse indicate that the Wnt1 protein functions in the induction of the mesencephalon and cerebellum. This gene was originally considered as a candidate gene for Joubert syndrome, an autosomal recessive disorder with cerebellar hypoplasia as a leading feature. However, further studies suggested that the gene mutations might not have a significant role in Joubert syndrome. This gene is clustered with another family member, WNT10B, in the chromosome 12q13 region.

Synonyms

WNT1; BMND16; INT1; OI15

Gene ID

7471

UniProt

P04628

Cellular Locus

Secreted, extracellular matrix, extracellular space

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:1000 - 1:4000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa Observed MW: 49kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WNT1 Rabbit pAb (APR24778N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7471

Uniprot URL

https://www.uniprot.org/uniprot/P04628

AA Sequence

TCWMRLPTLRAVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCTYSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNCTHTRVLHECL

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CSTB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
16988111 3 x 1.0 µg

CSTB sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Ask
View Details
Human Activating Transcription Factor 7 ELISA Kit
MBS035916-01 48 Well

Human Activating Transcription Factor 7 ELISA Kit

Ask
View Details
Human Activating Transcription Factor 7 ELISA Kit
MBS035916-02 96 Well

Human Activating Transcription Factor 7 ELISA Kit

Ask
View Details
Human Activating Transcription Factor 7 ELISA Kit
MBS035916-03 5x 96 Well

Human Activating Transcription Factor 7 ELISA Kit

Ask
View Details
Human Activating Transcription Factor 7 ELISA Kit
MBS035916-04 10x 96 Well

Human Activating Transcription Factor 7 ELISA Kit

Ask
View Details
Rat Mlh1/DNA mismatch repair protein Mlh1 ELISA Kit
MBS2904568-01 48 Well

Rat Mlh1/DNA mismatch repair protein Mlh1 ELISA Kit

Ask
View Details