Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C-Fos Rabbit pAb (APR24772N)

Product Specifications

Background

The Fos gene family consists of 4 members: FOS, FOSB, FOSL1, and FOSL2. These genes encode leucine zipper proteins that can dimerize with proteins of the JUN family, thereby forming the transcription factor complex AP-1. As such, the FOS proteins have been implicated as regulators of cell proliferation, differentiation, and transformation. In some cases, expression of the FOS gene has also been associated with apoptotic cell death.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality c-Fos Rabbit pAb (APR24772N) .

Synonyms

FOS; AP-1; C-FOS; p55; c-Fos

Gene ID

2353

UniProt

P01100

Cellular Locus

Cytoplasm, Endoplasmic reticulum, Nucleus, cytosol

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 28kDa/36kDa/40kDa Observed MW: 55-60KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2353

Uniprot URL

https://www.uniprot.org/uniprot/P01100

AA Sequence

TRAPHPFGVPAPSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Atp6v0c (NM_009729) Mouse Tagged ORF Clone
MR201148 10 µg

Atp6v0c (NM_009729) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2061066-01 0.1 mL

Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2061066-02 0.2 mL

Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2061066-03 0.5 mL

Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2061066-04 1 mL

Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)
MBS2061066-05 5 mL

Cy3-Linked Polyclonal Antibody to Cluster Of Differentiation 34 (CD34)

Sign In for Pricing
View Details