Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WWP2 Rabbit pAb (APR24767N)

Product Specifications

Background

This gene encodes a member of the Nedd4 family of E3 ligases, which play an important role in protein ubiquitination. The encoded protein contains four WW domains and may play a role in multiple processes including chondrogenesis and the regulation of oncogenic signaling pathways via interactions with Smad proteins and the tumor suppressor PTEN. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome 10.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality WWP2 Rabbit pAb (APR24767N) .

Synonyms

WWP2; AIP2; WWp2-like

Gene ID

11060

UniProt

O00308

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 35kDa/51kDa/86kDa/98kDa Observed MW: 105kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=11060

Uniprot URL

https://www.uniprot.org/uniprot/O00308

AA Sequence

VPNGSALTDGSQLPSRDSSGTAVAPENRHQPPSTNCFGGRSRTHRHSGASARTTPATGEQSPGARSRHRQPVKNSGHSGLANGTVNDEPTTATDPEEPSVVGVTSPPAAPLSVTPNPNTTSLPAPATPAEGEEPSTSGTQQLPAAAQAPDALPAGWEQRELPNGRVYYVDHNTKTTTWERPLPPGWEKRTDPRGRFYYVDHNTRTTTWQRPTAEYVRNYEQWQSQRNQLQGAMQHFSQRFLYQSSSASTD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FRMPD1 Antibody [DyLight 755]
NBP1-77082IR 0.1 mL

Rabbit Polyclonal FRMPD1 Antibody [DyLight 755]

Sign In for Pricing
View Details
JAK3 Protein Vector (Mouse) (pPB-N-His)
PV192875 500 ng

JAK3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Human B3GAT2 shRNA Plasmid
abx965160-01 150 µg

Human B3GAT2 shRNA Plasmid

Sign In for Pricing
View Details
Human B3GAT2 shRNA Plasmid
abx965160-02 300 µg

Human B3GAT2 shRNA Plasmid

Sign In for Pricing
View Details
ATG2B Antibody
7005-01 0.02 mg

ATG2B Antibody

Sign In for Pricing
View Details
ATG2B Antibody
7005-02 0.1 mg

ATG2B Antibody

Sign In for Pricing
View Details