Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Rabbit pAb (APR24763N)

Product Specifications

Background

The protein encoded by this gene belongs to the superfamily of small heat-shock proteins containing a conservative alpha-crystallin domain at the C-terminal part of the molecule. The protein is expressed preferentially in the heart and skeletal muscle. This protein regulates Myotonic Dystrophy Protein Kinase, which plays an important role in maintenance of muscle structure and function.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HSPB2 Rabbit pAb (APR24763N) .

Synonyms

HSPB2; HSP27; Hs.78846; LOH11CR1K; MKBP

Gene ID

3316

UniProt

Q16082

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 20kDa Observed MW: 20kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3316

Uniprot URL

https://www.uniprot.org/uniprot/Q16082

AA Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Homalomenol A
CS-BT-00373 1 Each

Homalomenol A

Sign In for Pricing
View Details
APP ELISA Kit (Human) (OKCD07066)
OKCD07066 96 Well

APP ELISA Kit (Human) (OKCD07066)

Sign In for Pricing
View Details
ProBNP Monoclonal Antibody, HRP Conjugated
bsm-43095M-HRP 100 µL

ProBNP Monoclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Taf5l (NM_133966) Mouse Tagged Lenti ORF Clone
MR209187L4 10 µg

Taf5l (NM_133966) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TSSC1 Antibody
orb1267253 400 μl

TSSC1 Antibody

Sign In for Pricing
View Details
Recombinant Human Heparan Sulfate-6-O-Sulfotransferase-3 CF
8568-ST-020 20 µg

Recombinant Human Heparan Sulfate-6-O-Sulfotransferase-3 CF

Sign In for Pricing
View Details