Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Histone H3 Rabbit pAb (APR24762N)

Product Specifications

Background

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4) . The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H3 family. Transcripts from this gene lack polyA tails; instead, they contain a palindromic termination element. This gene is located separately from the other H3 genes that are in the histone gene cluster on chromosome 6p22-p21.3.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Histone H3 Rabbit pAb (APR24762N) .

Synonyms

H3.4; H3/g; H3FT; H3t; HIST3H3; Histone H3; HIST1H3A

Gene ID

8290

UniProt

Q16695

Cellular Locus

Chromosome, Nucleus

Applications

WB (Mouse embryonic fibroblasts, Raw264.7, Rat brain, HNSCs, Arabidopsis thaliana, Homo sapiens, Mus musculus, Plasmodium falciparum, Rattus norvegicus, Oryza sativa, Gallus gallus, Danio rerio, Bombyx mori Linnaeus, Saccharomyces cerevisiae) IF (Mouse E16.5 neocortex, Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200 IP 1:50 - 1:200 ChIP 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 17KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8290

Uniprot URL

https://www.uniprot.org/uniprot/Q16695

AA Sequence

REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alexa Fluor® 488 anti-mouse CD31
GT00677 25 µg

Alexa Fluor® 488 anti-mouse CD31

Sign In for Pricing
View Details
QPCT (Glutaminyl-Peptide Cyclotransferase, Glutaminyl Cyclase, QC, sQC, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase, EC) discontinued
361048-01 50 µL

QPCT (Glutaminyl-Peptide Cyclotransferase, Glutaminyl Cyclase, QC, sQC, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase, EC) discontinued

Sign In for Pricing
View Details
QPCT (Glutaminyl-Peptide Cyclotransferase, Glutaminyl Cyclase, QC, sQC, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase, EC) discontinued
361048-02 100 µL

QPCT (Glutaminyl-Peptide Cyclotransferase, Glutaminyl Cyclase, QC, sQC, Glutaminyl-tRNA Cyclotransferase, Glutamyl Cyclase, EC) discontinued

Sign In for Pricing
View Details
SDHF1 Antibody
MBS9520797-01 0.04 mL

SDHF1 Antibody

Sign In for Pricing
View Details
SDHF1 Antibody
MBS9520797-02 0.1 mL

SDHF1 Antibody

Sign In for Pricing
View Details
SDHF1 Antibody
MBS9520797-03 0.2 mL

SDHF1 Antibody

Sign In for Pricing
View Details