What is the catalog number for Uhrf2 Rabbit pAb (APR24760N)?

The catalog number for Uhrf2 Rabbit pAb (APR24760N) is APR24760N.

What sizes are available for Uhrf2 Rabbit pAb (APR24760N)?

Uhrf2 Rabbit pAb (APR24760N) is available in the following size(s): 50 µL, 100 µL, 200 µL.

How many pack sizes does Uhrf2 Rabbit pAb (APR24760N) come in?

Uhrf2 Rabbit pAb (APR24760N) is available in 3 different pack sizes.

Is Uhrf2 Rabbit pAb (APR24760N) in stock?

Uhrf2 Rabbit pAb (APR24760N) is currently made to order / not held in immediate stock. Contact us for lead time.

Uhrf2 Rabbit pAb (APR24760N)

Product Specifications

Background

This gene encodes a nuclear protein which is involved in cell-cycle regulation. The encoded protein is a ubiquitin-ligase capable of ubiquinating PCNP (PEST-containing nuclear protein), and together they may play a role in tumorigenesis. The encoded protein contains an NIRF_N domain, a PHD finger, a set- and ring-associated (SRA) domain, and a RING finger domain and several of these domains have been shown to be essential for the regulation of cell proliferation. This protein may also have a role in intranuclear degradation of polyglutamine aggregates. Alternative splicing results in multiple transcript variants some of which are non-protein coding.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Uhrf2 Rabbit pAb (APR24760N) .

Synonyms

UHRF2; NIRF; RNF107; TDRD23; URF2; Uhrf2

Gene ID

109113

Cellular Locus

Nucleus

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 56kDa/89kDa Observed MW: 110kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=109113

AA Sequence

DSSLPSTSKQNDAQVKPSSHNPPKVKKTARGGSSSQPSTSARTCLIDPGFGLYKVNELVDARDVGLGAWFEAHIHSVTRASDGHSRGKTPLKNGSSYKRTNGNVNHNSKENTNKLDNVPSTSNSDSVAADEDVIYHIEYDEYPESGILEMNVKDLRPRARTILKWNELNVGDVVMVNYNVENPGKRGFWYDAEITTLKTISRTKKEVRVKVFLGGSEGTLNDCRVMSVDEIFKIEKPGAHPISFADGKFLRKNDPECDLCGGDPDKTCHMCSCHKCGEKRDPNM