Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR24742N)

Product Specifications

Background

The hypoxia inducible factor (HIF) is a transcriptional complex that is involved in oxygen homeostasis. At normal oxygen levels, the alpha subunit of HIF is targeted for degration by prolyl hydroxylation. This gene encodes an enzyme responsible for this post-translational modification. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the upstream RAB4B (RAB4B, member RAS oncogene family) gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality Prolyl hydroxylase PHD1 (EGLN2) Rabbit pAb (APR24742N) .

Synonyms

EGLN2; EIT6; HIF-PH1; HIFPH1; HPH-1; HPH-3; PHD1

Gene ID

112398

UniProt

Q96KS0

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:2000 IP 1:20 - 1:50

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 40kDa/43kDa Observed MW: 43kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=112398

Uniprot URL

https://www.uniprot.org/uniprot/Q96KS0

AA Sequence

MSCSCSSGSGEASAGLMEEALPSAPERLALDYIVPCMRYYGICVKDSFLGAALGGRVLAEVEALKRGGRLRDGQLVSQRAIPPRSIRGDQIAWVEGHEPGC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit
MBS8822407-01 48 Well

Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit
MBS8822407-02 96 Well

Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit
MBS8822407-03 5x 96 Well

Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit
MBS8822407-04 10x 96 Well

Human PIIICP (Procollagen III C-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA li
MBS6271097-01 0.1 mL

ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA li

Sign In for Pricing
View Details
ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA li
MBS6271097-02 5x 0.1 mL

ACSL1, CT (ACSL1, FACL1, FACL2, LACS, LACS1, LACS2, Long-chain-fatty-acid-CoA ligase 1, Acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 1, Long-chain acyl-CoA synthetase 2, Long-chain fatty acid-CoA ligase 2, Palmitoyl-CoA ligase 1, Palmitoyl-CoA li

Sign In for Pricing
View Details