Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX1 Rabbit pAb (APR24738N)

Product Specifications

Background

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CBX1 Rabbit pAb (APR24738N) .

Synonyms

CBX1; CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta

Gene ID

10951

UniProt

P83916

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10951

Uniprot URL

https://www.uniprot.org/uniprot/P83916

AA Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 18 (DA7), CF594 conjugate, 0.1mg/mL
BNC940198-500 1x 500 µL

Cytokeratin 18 (DA7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SCFD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G4]
TA504721AM 100 µL

SCFD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5G4]

Sign In for Pricing
View Details
Tex15 Mouse Gene Knockout Kit (CRISPR)
KN517432 1 Kit

Tex15 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL
BNC681324-500 1x 500 µL

MLH1 (MutL Homolog 1) (MLH1/1324), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
APC Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428UE-01 25 µg

APC Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details
APC Anti-Mouse CD45R (B220) Antibody[RA3-6B2]
AN00428UE-02 100 µg

APC Anti-Mouse CD45R (B220) Antibody[RA3-6B2]

Sign In for Pricing
View Details