Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBX1 Rabbit pAb (APR24738N)

Product Specifications

Background

This gene encodes a highly conserved nonhistone protein, which is a member of the heterochromatin protein family . The protein is enriched in the heterochromatin and associated with centromeres. The protein has a single N-terminal chromodomain which can bind to histone proteins via methylated lysine residues, and a C-terminal chromo shadow-domain (CSD) which is responsible for the homodimerization and interaction with a number of chromatin-associated nonhistone proteins. The protein may play an important role in the epigenetic control of chromatin structure and gene expression. Several related pseudogenes are located on chromosomes 1, 3, and X. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CBX1 Rabbit pAb (APR24738N) .

Synonyms

CBX1; CBX; HP1-BETA; HP1Hs-beta; HP1Hsbeta; M31; MOD1; p25beta

Gene ID

10951

UniProt

P83916

Cellular Locus

Nucleus

Dilution

WB 1:500 - 1:1000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 21kDa Observed MW: 21kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10951

Uniprot URL

https://www.uniprot.org/uniprot/P83916

AA Sequence

MGKKQNKKKVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEFLQSQKTAHETDKSEGGKRKADSDSEDKGEESKPKKKKEESEKPRGFARGLEPERIIGATDSSGELMFLMKWKNSDEADLVPAKEANVKCPQVVISFYEERLTWHSYPSEDDDKKDDKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EXTL3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-13123R-BF750 100 µL

EXTL3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
Phospho-MEF2C (Ser387) Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-5481R-PE-Cy5.5 100 µL

Phospho-MEF2C (Ser387) Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Porcine Galanin, GAL GENLISA ELISA
KLP0137 96 Well

Porcine Galanin, GAL GENLISA ELISA

Sign In for Pricing
View Details
Sheep Human Hemoglobin F Antibody
orb1519262 2 mL

Sheep Human Hemoglobin F Antibody

Sign In for Pricing
View Details
UBFD1 Rabbit Polyclonal Antibody (FITC)
orb2087940 100 µL

UBFD1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
B230216G23Rik Lentiviral Activation Particles (m2)
sc-435631-LAC-2 200 µL

B230216G23Rik Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details