Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] CARM1 Rabbit pAb (APR24737N)

Product Specifications

Background

This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts specifically on histones and other chromatin-associated proteins and is involved in regulation of gene expression. The enzyme may act in association with other proteins or within multi-protein complexes and may play a role in cell type-specific functions and cell lineage specification. A related pseudogene is located on chromosome 9.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] CARM1 Rabbit pAb (APR24737N) .

Synonyms

CARM1; PRMT4

Gene ID

10498

UniProt

Q86X55

Cellular Locus

Cytoplasm, Nucleus

Dilution

WB 1:200 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 41kDa/63kDa/65kDa Observed MW: 63KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=10498

Uniprot URL

https://www.uniprot.org/uniprot/Q86X55

AA Sequence

TEPLTHWYQVRCLFQSPLFAKAGDTLSGTCLLIANKRQSYDISIVAQVDQTGSKSSNLLDLKNPFFRYTGTTPSPPPGSHYTSPSENMWNTGSTYNLSSGMAVAGMPTAYDLSSVIASGSSVGHNNLIPLANTGIVNHTHSRMGSIMSTGIVQGSSGAQGSGGGSTSAHYAVNSQFTMGGPAISMASPMSIPTNTMHYGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MBTD1 activation kit by CRISPRa
GA110268 1 Kit

Human MBTD1 activation kit by CRISPRa

Sign In for Pricing
View Details
EBNA1 binding protein 2 (EBNA1BP2) (C-term) Rabbit Polyclonal Antibody
AP51355PU-N 400 µL

EBNA1 binding protein 2 (EBNA1BP2) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse C4bp-ps1 activation kit by CRISPRa
GA200469 1 Kit

Mouse C4bp-ps1 activation kit by CRISPRa

Sign In for Pricing
View Details
MTSS1 Human Gene Knockout Kit (CRISPR)
KN218273BN 1 Kit

MTSS1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue Total RNA, Lung
CR562844 5 µg

Tissue Total RNA, Lung

Sign In for Pricing
View Details
MERTK Human Gene Knockout Kit (CRISPR)
KN215289BN 1 Kit

MERTK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details