Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBD2 Rabbit pAb (APR24733N)

Product Specifications

Background

DNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD) . Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality MBD2 Rabbit pAb (APR24733N) .

Synonyms

MBD2; DMTase; NY-CO-41

Gene ID

8932

UniProt

Q9UBB5

Cellular Locus

Nucleus

Applications

WB (Human hepatocellular carcinoma cell line)

Dilution

WB 1:200 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa/43kDa Observed MW: 53kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=8932

Uniprot URL

https://www.uniprot.org/uniprot/Q9UBB5

AA Sequence

DLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADTEEMDIEMDSGDEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCL6 Antibody
orb1331147 100 µg

BCL6 Antibody

Sign In for Pricing
View Details
ARL8A Rabbit Polyclonal Antibody
E10G00961 100 µL

ARL8A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Golgi Membrane Protein 1 (GOLM1) Protein
abx066898-01 10 µg

Mouse Golgi Membrane Protein 1 (GOLM1) Protein

Sign In for Pricing
View Details
Mouse Golgi Membrane Protein 1 (GOLM1) Protein
abx066898-02 50 µg

Mouse Golgi Membrane Protein 1 (GOLM1) Protein

Sign In for Pricing
View Details
Mouse Golgi Membrane Protein 1 (GOLM1) Protein
abx066898-03 100 µg

Mouse Golgi Membrane Protein 1 (GOLM1) Protein

Sign In for Pricing
View Details
Mouse Golgi Membrane Protein 1 (GOLM1) Protein
abx066898-04 200 µg

Mouse Golgi Membrane Protein 1 (GOLM1) Protein

Sign In for Pricing
View Details