Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHD3 Rabbit pAb (APR24729N)

Product Specifications

Background

This gene encodes a member of the CHD family of proteins which are characterized by the presence of chromo (chromatin organization modifier) domains and SNF2-related helicase/ATPase domains. This protein is one of the components of a histone deacetylase complex referred to as the Mi-2/NuRD complex which participates in the remodeling of chromatin by deacetylating histones. Chromatin remodeling is essential for many processes including transcription. Autoantibodies against this protein are found in a subset of patients with dermatomyositis. Three alternatively spliced transcripts encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CHD3 Rabbit pAb (APR24729N) .

Synonyms

CHD3; Mi-2a; Mi2-ALPHA; ZFH

Gene ID

1107

UniProt

Q12873

Cellular Locus

Cytoplasm, Nucleus, centrosome, cytoskeleton, microtubule organizing center

Dilution

WB 1:200 - 1:1000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 222kDa/226kDa/233kDa Observed MW: 280kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1107

Uniprot URL

https://www.uniprot.org/uniprot/Q12873

AA Sequence

ERSILSRLASKGTEPHPTPAYPPGPYATPPGYGAAFSAAPVGALAAAGANYSQMPAGSFITAATNGPPVLVKKEKEMVGALVSDGLDRKEPRAGEVICIDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Ligase 1 (1A9), Biotin conjugate, 0.1mg/mL
BNCB2177-500 1x 500 µL

DNA Ligase 1 (1A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-DRB (LN-3), CF568 conjugate, 0.1mg/mL
BNC680057-500 1x 500 µL

HLA-DRB (LN-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TCTP (TPT1) Rabbit Polyclonal Antibody
AP06666PU-N 100 µg

TCTP (TPT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TWIST2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F11]
TA805301BM 100 µL

TWIST2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F11]

Sign In for Pricing
View Details
PNMA6A Human Gene Knockout Kit (CRISPR)
KN416612 1 Kit

PNMA6A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TEP1 Human Gene Knockout Kit (CRISPR)
KN223614BN 1 Kit

TEP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details