Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP1A1 Rabbit pAb (APR24677N)

Product Specifications

Background

This gene, CYP1A1, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by some polycyclic aromatic hydrocarbons (PAHs), some of which are found in cigarette smoke. The enzyme's endogenous substrate is unknown; however, it is able to metabolize some PAHs to carcinogenic intermediates. The gene has been associated with lung cancer risk. A related family member, CYP1A2, is located approximately 25 kb away from CYP1A1 on chromosome 15. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CYP1A1 Rabbit pAb (APR24677N) .

Synonyms

CYP1A1; AHH; AHRR; CP11; CYP1; CYPIA1; P1-450; P450-C; P450DX

Gene ID

1543

UniProt

P04798

Cellular Locus

Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein

Applications

WB (Rattus norvegicus) IHC (Rattus norvegicus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa/20kDa/58kDa Observed MW: 58KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1543

Uniprot URL

https://www.uniprot.org/uniprot/P04798

AA Sequence

AICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFGAGFDTVTTAISWSLMYLVMNPRVQRKIQEELDTVIGRSRRPRLSDRSHLPYMEAFILETFRHSSFVPFTIPHSTTRDTSLKGFYIPKGRCVFVNQWQINHDQKLWVNPSEFLPERFLTPDGAIDKVLSEKVIIFGMGKRKCIGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL
BNC810010-500 1x 500 µL

MART-1 / Melan-A (M2-9E3), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
JM-9
T208789-01 10 mg

JM-9

Sign In for Pricing
View Details
JM-9
T208789-02 50 mg

JM-9

Sign In for Pricing
View Details
CD226 (CD226 Antigen, Adhesion Glycoprotein, DNAX Accessory Molecule 1, DNAM1, DNAM-1, Platelet and T cell Activation Antigen 1, PTA1, TLiSA1) (Azide Free)
C2548-97G2 1 mg

CD226 (CD226 Antigen, Adhesion Glycoprotein, DNAX Accessory Molecule 1, DNAM1, DNAM-1, Platelet and T cell Activation Antigen 1, PTA1, TLiSA1) (Azide Free)

Sign In for Pricing
View Details
Human Alpha B Crystallin ELISA Kit
MBS732898-01 48 Strip Well (Competitive)

Human Alpha B Crystallin ELISA Kit

Sign In for Pricing
View Details
Human Alpha B Crystallin ELISA Kit
MBS732898-02 48 Strip Well (Sandwich)

Human Alpha B Crystallin ELISA Kit

Sign In for Pricing
View Details