Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] Caspase-3 Rabbit pAb (APR24674N)

Product Specifications

Background

This gene encodes a protein which is a member of the cysteine-aspartic acid protease (caspase) family. Sequential activation of caspases plays a central role in the execution-phase of cell apoptosis. Caspases exist as inactive proenzymes which undergo proteolytic processing at conserved aspartic residues to produce two subunits, large and small, that dimerize to form the active enzyme. This protein cleaves and activates caspases 6, 7 and 9, and the protein itself is processed by caspases 8, 9 and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. Alternative splicing of this gene results in two transcript variants that encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] Caspase-3 Rabbit pAb (APR24674N) .

Synonyms

CPP32; CPP32B; SCA-1; Active Caspase 3; CASP3; active Caspase-3; Caspase 3; Caspase-3 p12; caspase-3

Gene ID

836

UniProt

P42574

Cellular Locus

Cytoplasm

Applications

WB (HeLa, Human uterine stromal cells, B6, NMuMG, Mus musculus, Homo sapiens, Ctenopharyngodon idellus, quails, Rattus norvegicus, lamprey, Bos taurus, Panax notoginseng (Burk.) F. H. Chen ex C. Chow, Gallus gallus, Spodoptera frugiperda, Sus scrofa) IHC (Mouse kidney, Rat brain, Mus musculus, Rattus norvegicus, Danio rerio, Actinopterygii) FC (Mus musculus) Co-IP (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 31kDa Observed MW: 32KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=836

Uniprot URL

https://www.uniprot.org/uniprot/P42574

AA Sequence

FHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFII

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Paraneoplastic Antigen Ma2, Recombinant Human, aa2-361, His-SUMO-tag (PNMA2)
406016-01 20 µg

Paraneoplastic Antigen Ma2, Recombinant Human, aa2-361, His-SUMO-tag (PNMA2)

Ask
View Details
Paraneoplastic Antigen Ma2, Recombinant Human, aa2-361, His-SUMO-tag (PNMA2)
406016-02 100 µg

Paraneoplastic Antigen Ma2, Recombinant Human, aa2-361, His-SUMO-tag (PNMA2)

Ask
View Details
WDR49 Antibody, Biotin conjugated
MBS1497430-01 0.05 mg

WDR49 Antibody, Biotin conjugated

Ask
View Details
WDR49 Antibody, Biotin conjugated
MBS1497430-02 0.1 mg

WDR49 Antibody, Biotin conjugated

Ask
View Details
WDR49 Antibody, Biotin conjugated
MBS1497430-03 5x 0.1 mg

WDR49 Antibody, Biotin conjugated

Ask
View Details
MAGED2 (Melanoma-associated Antigen D2, MAGE-D2 Antigen, Breast Cancer-associated Gene 1 Protein, BCG-1, 11B6, Hepatocellular Carcinoma-associated Protein JCL-1, BCG1) (MaxLight 750) discontinued
129327-ML750 100 µL

MAGED2 (Melanoma-associated Antigen D2, MAGE-D2 Antigen, Breast Cancer-associated Gene 1 Protein, BCG-1, 11B6, Hepatocellular Carcinoma-associated Protein JCL-1, BCG1) (MaxLight 750) discontinued

Ask
View Details