Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD45 Rabbit pAb (APR24636N)

Product Specifications

Background

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transformation. This PTP contains an extracellular domain, a single transmembrane segment and two tandem intracytoplasmic catalytic domains, and thus is classified as a receptor type PTP. This PTP has been shown to be an essential regulator of T- and B-cell antigen receptor signaling. It functions through either direct interaction with components of the antigen receptor complexes, or by activating various Src family kinases required for the antigen receptor signaling. This PTP also suppresses JAK kinases, and thus functions as a regulator of cytokine receptor signaling. Alternatively spliced transcripts variants of this gene, which encode distinct isoforms, have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD45 Rabbit pAb (APR24636N) .

Synonyms

B220; CD45; CD45R; GP180; L-CA; LCA; LY5; T200; PTPRC

Gene ID

5788

UniProt

P08575

Cellular Locus

Membrane, Membrane raft, Single-pass type I membrane protein

Applications

IHC (Human chronic myeloid leukemia cells, Mus musculus) IF (Human chronic myeloid leukemia cells, Mus musculus) WB (Mus musculus) FC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 130kDa/147kDa Observed MW: 180-250KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5788

Uniprot URL

https://www.uniprot.org/uniprot/P08575

AA Sequence

RCLMVQVEAQYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNSNVIPYDYNRVPLKHELE

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ACTR6 Peptide - C-terminal region
MBS3242345-01 0.1 mg

ACTR6 Peptide - C-terminal region

Ask
View Details
ACTR6 Peptide - C-terminal region
MBS3242345-02 5x 0.1 mg

ACTR6 Peptide - C-terminal region

Ask
View Details
Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A12]
TA501858BM 100 µL

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI7A12]

Ask
View Details
Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TCP23 Polyclonal Antibody
MBS9007105 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) TCP23 Polyclonal Antibody

Ask
View Details
Mouse Pnisr Pre-designed siRNA Set A
SI110808A 1 Each

Mouse Pnisr Pre-designed siRNA Set A

Ask
View Details