Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIN1 Rabbit pAb (APR24628N)

Product Specifications

Background

Peptidyl-prolyl cis/trans isomerases (PPIases) catalyze the cis/trans isomerization of peptidyl-prolyl peptide bonds. This gene encodes one of the PPIases, which specifically binds to phosphorylated ser/thr-pro motifs to catalytically regulate the post-phosphorylation conformation of its substrates. The conformational regulation catalyzed by this PPIase has a profound impact on key proteins involved in the regulation of cell growth, genotoxic and other stress responses, the immune response, induction and maintenance of pluripotency, germ cell development, neuronal differentiation, and survival. This enzyme also plays a key role in the pathogenesis of Alzheimer's disease and many cancers. Multiple alternatively spliced transcript variants have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality PIN1 Rabbit pAb (APR24628N) .

Synonyms

PIN1; DOD; UBL5

Gene ID

5300

UniProt

Q13526

Cellular Locus

Cytoplasm, Nucleus, Nucleus speckle

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=5300

Uniprot URL

https://www.uniprot.org/uniprot/Q13526

AA Sequence

MADEEKLPPGWEKRMSRSSGRVYYFNHITNASQWERPSGNSSSGGKNGQGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FBXO9 siRNA Oligos set (Human)
20347171 3x 5 nmol

FBXO9 siRNA Oligos set (Human)

Sign In for Pricing
View Details
NT-3, CT (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (FITC) discontinued
N5400-01C-FITC 200 µL

NT-3, CT (Neurotrophin 3, Neurotrophin-3, NT3, NTF3, HDNF, MGC129711, Nerve Growth Factor 2, Nerve Growth Factor-2, NGF2, NGF-2, Neurotrophic Factor) (FITC) discontinued

Sign In for Pricing
View Details
ENTPD7 Antibody; Biotin conjugated
MBS7003038-01 0.05 mg

ENTPD7 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ENTPD7 Antibody; Biotin conjugated
MBS7003038-02 0.1 mg

ENTPD7 Antibody; Biotin conjugated

Sign In for Pricing
View Details
ENTPD7 Antibody; Biotin conjugated
MBS7003038-03 5x 0.1 mg

ENTPD7 Antibody; Biotin conjugated

Sign In for Pricing
View Details
Sumo1 Mouse shRNA Lentiviral Particle (Locus ID 22218)
TL519017V 500 µL Each

Sumo1 Mouse shRNA Lentiviral Particle (Locus ID 22218)

Sign In for Pricing
View Details