Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF4/p40-phox Rabbit pAb (APR24618N)

Product Specifications

Background

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI (3) kinase, which suggests its role in PI (3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NCF4/p40-phox Rabbit pAb (APR24618N) .

Synonyms

NCF4; CGD3; NCF; P40PHOX; SH3PXD4

Gene ID

4689

UniProt

Q15080

Cellular Locus

Cytoplasm, Cytoplasmic side, Endosome membrane, Membrane, Peripheral membrane protein, cytosol

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4689

Uniprot URL

https://www.uniprot.org/uniprot/Q15080

AA Sequence

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DMEM (HG) With high glucose, L-glutamine, and sodium pyruvate. W/O phenol red and sodium bicarbonate.
DMP01-10LT 10 L

DMEM (HG) With high glucose, L-glutamine, and sodium pyruvate. W/O phenol red and sodium bicarbonate.

Sign In for Pricing
View Details
Pabpc4 3'UTR GFP Stable Cell Line
TU265745 1.0 mL

Pabpc4 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Phospho-RSK2 (Ser386) Blocking Peptide
MBS9616004-01 1 mg

Phospho-RSK2 (Ser386) Blocking Peptide

Sign In for Pricing
View Details
Phospho-RSK2 (Ser386) Blocking Peptide
MBS9616004-02 5x 1 mg

Phospho-RSK2 (Ser386) Blocking Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to SOX2
11-7554-25 25 µg

Polyclonal Antibody to SOX2

Sign In for Pricing
View Details
AKT (pY315) Blocking Peptide
MBS822579-01 1 mg

AKT (pY315) Blocking Peptide

Sign In for Pricing
View Details