Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NCF4/p40-phox Rabbit pAb (APR24618N)

Product Specifications

Background

The protein encoded by this gene is a cytosolic regulatory component of the superoxide-producing phagocyte NADPH-oxidase, a multicomponent enzyme system important for host defense. This protein is preferentially expressed in cells of myeloid lineage. It interacts primarily with neutrophil cytosolic factor 2 (NCF2/p67-phox) to form a complex with neutrophil cytosolic factor 1 (NCF1/p47-phox), which further interacts with the small G protein RAC1 and translocates to the membrane upon cell stimulation. This complex then activates flavocytochrome b, the membrane-integrated catalytic core of the enzyme system. The PX domain of this protein can bind phospholipid products of the PI (3) kinase, which suggests its role in PI (3) kinase-mediated signaling events. The phosphorylation of this protein was found to negatively regulate the enzyme activity. Alternatively spliced transcript variants encoding distinct isoforms have been observed.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality NCF4/p40-phox Rabbit pAb (APR24618N) .

Synonyms

NCF4; CGD3; NCF; P40PHOX; SH3PXD4

Gene ID

4689

UniProt

Q15080

Cellular Locus

Cytoplasm, Cytoplasmic side, Endosome membrane, Membrane, Peripheral membrane protein, cytosol

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 39kDa Observed MW: 40KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4689

Uniprot URL

https://www.uniprot.org/uniprot/Q15080

AA Sequence

MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQEIAEMRIPALNAYMKSLLSLPVWVLMDEDVRIFFYQSPYDSEQVPQALRRLRPRTRKVKSVSPQGNSVDRMAAPRAEALFDFTGNSKLELN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RXR gamma (Retinoid X Receptor gamma, Retinoic Acid Receptor RXR gamma, Retanoic X Receptor gamma, RXRgamma, RXRG, Nuclear Receptor Subfamily 2 Group B Member 3, NR2B3, OTTHUMP00000060418, RXRC) (FITC) discontinued
R9990-07E-FITC 100 µL

RXR gamma (Retinoid X Receptor gamma, Retinoic Acid Receptor RXR gamma, Retanoic X Receptor gamma, RXRgamma, RXRG, Nuclear Receptor Subfamily 2 Group B Member 3, NR2B3, OTTHUMP00000060418, RXRC) (FITC) discontinued

Sign In for Pricing
View Details
MRPS31 Rabbit pAb (APR19539N)
APR19539N-01 50 µL

MRPS31 Rabbit pAb (APR19539N)

Sign In for Pricing
View Details
MRPS31 Rabbit pAb (APR19539N)
APR19539N-02 100 µL

MRPS31 Rabbit pAb (APR19539N)

Sign In for Pricing
View Details
MRPS31 Rabbit pAb (APR19539N)
APR19539N-03 200 µL

MRPS31 Rabbit pAb (APR19539N)

Sign In for Pricing
View Details
Sulfur 1000 ug/g (1000 PPM) for AA and ICP 100 grams in Base Oil 20
DSS8-2Y 100 mL

Sulfur 1000 ug/g (1000 PPM) for AA and ICP 100 grams in Base Oil 20

Sign In for Pricing
View Details
TRNAN2 CRISPR All-in-one AAV vector set (with saCas9)(Human)
48226151 3x 1.0 µg DNA

TRNAN2 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details