Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL13 Rabbit pAb (APR24611N)

Product Specifications

Background

This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality IL13 Rabbit pAb (APR24611N) .

Synonyms

IL13; IL-13; P600

Gene ID

3596

UniProt

P35225

Cellular Locus

Secreted

Applications

WB (Homo sapiens) IHC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 15kDa Observed MW: 13KDa/17-35KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=3596

Uniprot URL

https://www.uniprot.org/uniprot/P35225

AA Sequence

LTCLGGFASPGPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGQFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NOTCH3 (Notch Homolog 3 (Drosophila), CADASIL, CASIL) (Biotin)
249408-Biotin 100 µL

NOTCH3 (Notch Homolog 3 (Drosophila), CADASIL, CASIL) (Biotin)

Sign In for Pricing
View Details
MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 light chain 3 alpha) (APC) discontinued
038098-APC 200 µL

MAP1LC3A (D106) (LC3, APG8A, Microtubule-associated proteins 1A/1B light chain 3A, Autophagy-related protein LC3 A, Autophagy-related ubiquitin-like modifier LC3 A, MAP1 light chain 3-like protein 1, MAP1A/MAP1B light chain 3 A, Microtubule-associated protein 1 light chain 3 alpha) (APC) discontinued

Sign In for Pricing
View Details
CDX1 (Caudal Type Homeobox 1, MGC116915) (PE)
244560-PE 100 µL

CDX1 (Caudal Type Homeobox 1, MGC116915) (PE)

Sign In for Pricing
View Details
Mouse Monoclonal Lgr6 Antibody (OTI2A3) [FITC]
NBP2-72119F 0.1 mL

Mouse Monoclonal Lgr6 Antibody (OTI2A3) [FITC]

Sign In for Pricing
View Details
Zebrafish TPM1 Rabbit Polyclonal Antibody (Fluoro647)
orb3129925 100 µg

Zebrafish TPM1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Block for Dry Bath Incubator, 20x0.5ml + 15x1.5ml
TT-100-DH-Block-E 1 Unit

Block for Dry Bath Incubator, 20x0.5ml + 15x1.5ml

Sign In for Pricing
View Details