Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HER2 / ErbB2 Rabbit pAb (APR24596N)

Product Specifications

Background

This gene encodes a member of the epidermal growth factor (EGF) receptor family of receptor tyrosine kinases. This protein has no ligand binding domain of its own and therefore cannot bind growth factors. However, it does bind tightly to other ligand-bound EGF receptor family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways, such as those involving mitogen-activated protein kinase and phosphatidylinositol-3 kinase. Allelic variations at amino acid positions 654 and 655 of isoform a (positions 624 and 625 of isoform b) have been reported, with the most common allele, Ile654/Ile655, shown here. Amplification and/or overexpression of this gene has been reported in numerous cancers, including breast and ovarian tumors. Alternative splicing results in several additional transcript variants, some encoding different isoforms and others that have not been fully characterized.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality HER2 / ErbB2 Rabbit pAb (APR24596N) .

Synonyms

ERBB2; CD340; HER-2; HER-2/neu; HER2; MLN 19; NEU; NGL; TKR1; erb-b2 receptor tyrosine kinase 2; HER2/ErbB2; ErbB2; MLN19

Gene ID

2064

UniProt

P04626

Cellular Locus

Cell membrane, Cytoplasm, Nucleus, Nucleus, Single-pass type I membrane protein, perinuclear region

Applications

WB (Mus musculus, Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 62kDa/70kDa/97kDa/134kDa/136kDa/137kDa Observed MW: 185KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=2064

Uniprot URL

https://www.uniprot.org/uniprot/P04626

AA Sequence

ARPAGATLERPKTLSPGKNGVVKDVFAFGGAVENPEYLTPQGGAAPQPHPPPAFSPAFDNLYYWDQDPPERGAPPSTFKGTPTAENPEYLGLDVPV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AS-252424
B2180-25 25 mg

AS-252424

Sign In for Pricing
View Details
7-[ (tert-butoxy) carbonyl]-5H,6H,7H,8H-imidazo[1,5-a]pyrazine-1-carboxylic acid
KWB24816-01 100 mg

7-[ (tert-butoxy) carbonyl]-5H,6H,7H,8H-imidazo[1,5-a]pyrazine-1-carboxylic acid

Sign In for Pricing
View Details
7-[ (tert-butoxy) carbonyl]-5H,6H,7H,8H-imidazo[1,5-a]pyrazine-1-carboxylic acid
KWB24816-02 1 g

7-[ (tert-butoxy) carbonyl]-5H,6H,7H,8H-imidazo[1,5-a]pyrazine-1-carboxylic acid

Sign In for Pricing
View Details
FAM177B siRNA (Human)
CRJ8099-01 15 nmol

FAM177B siRNA (Human)

Sign In for Pricing
View Details
FAM177B siRNA (Human)
CRJ8099-02 30 nmol

FAM177B siRNA (Human)

Sign In for Pricing
View Details
Phospho-TCF3 (Ser39) Rabbit pAb
E47R4662 100 µL

Phospho-TCF3 (Ser39) Rabbit pAb

Sign In for Pricing
View Details