Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TorsinA/TOR1A Rabbit pAb (APR24591N)

Product Specifications

Background

The protein encoded by this gene is a member of the AAA family of adenosine triphosphatases (ATPases), is related to the Clp protease/heat shock family and is expressed prominently in the substantia nigra pars compacta. Mutations in this gene result in the autosomal dominant disorder, torsion dystonia 1.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality TorsinA/TOR1A Rabbit pAb (APR24591N) .

Synonyms

TOR1A; DQ2; DYT1; torsin-1A

Gene ID

1861

UniProt

O14656

Cellular Locus

Cell projection, Cytoplasm, Cytoplasmic vesicle, Cytoplasmic vesicle membrane, Endoplasmic reticulum lumen, Nucleus membrane, Peripheral membrane protein, cytoskeleton, growth cone, secretory vesicle, synaptic vesicle

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 22kDa/37kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1861

Uniprot URL

https://www.uniprot.org/uniprot/O14656

AA Sequence

KDLDDNLFGQHLAKKIILNAVFGFINNPKPKKPLTLSLHGWTGTGKNFVSKIIAENIYEGGLNSDYVHLFVATLHFPHASNITLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDYYDLVDGVSYQKAMFIFLSNAGAERITDVALDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLIDRNLIDYFVPFLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSDKGCKTVFTKLDYYYDD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL
BNC940204-100 1x 100 µL

Complement C4d (C4D204), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-100 1x 100 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-500 1x 500 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF594 conjugate, 0.1mg/mL
BNC941052-500 1x 500 µL

CD3e (B-B12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL
BNC941820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL
BNC401927-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1A2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details