Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF1 Rabbit pAb (APR24571N)

Product Specifications

Background

SLAM-induced signal-transduction events in T-lymphocytes are different from those in B-cells. Two modes ofSLAM signaling are likely to exist: one in which the inhibitor SH2D1A acts as a negative regulator and another inwhich protein-tyrosine phosphatase 2C (PTPN11) -dependent signal transduction operates.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality SLAMF1 Rabbit pAb (APR24571N) .

Synonyms

SLAMF1; CD150; CDw150; SLAM

Gene ID

6504

UniProt

Q13291

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 33kDa/37kDa/40kDa Observed MW: 37kDa/65kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6504

Uniprot URL

https://www.uniprot.org/uniprot/Q13291

AA Sequence

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp536 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K4268904 1.0 µg DNA

Zfp536 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Mouse Human CD69
E2790167 100 µL

Mouse Human CD69

Sign In for Pricing
View Details
Dedd (NM_031800) Rat Tagged ORF Clone Lentiviral Particle
RR205992L4V 200 µL

Dedd (NM_031800) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Phyto Cmm Agar Base (SCM Medium)
PHM005-100G 100 g

Phyto Cmm Agar Base (SCM Medium)

Sign In for Pricing
View Details
c-Myc (MYC) Rabbit Polyclonal Antibody
AP02576PU-N 100 µL

c-Myc (MYC) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Thoc7 (BC054419) Mouse Tagged ORF Clone
MG202136 10 µg

Thoc7 (BC054419) Mouse Tagged ORF Clone

Sign In for Pricing
View Details