Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2C/p18-INK4C Rabbit pAb (APR24569N)

Product Specifications

Background

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to interact with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. Ectopic expression of this gene was shown to suppress the growth of human cells in a manner that appears to correlate with the presence of a wild-type RB1 function. Studies in the knockout mice suggested the roles of this gene in regulating spermatogenesis, as well as in suppressing tumorigenesis. Two alternatively spliced transcript variants of this gene, which encode an identical protein, have been reported.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CDKN2C/p18-INK4C Rabbit pAb (APR24569N) .

Synonyms

CDKN2C; INK4C; p18; p18-INK4C

Gene ID

1031

UniProt

P42773

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 18kDa Observed MW: 18kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1031

Uniprot URL

https://www.uniprot.org/uniprot/P42773

AA Sequence

MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRGANPDLKDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLRVVEFLVKHTASNVGHRNHKGDTACDLARLYGRNEVVSLMQANGAGGATNLQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (PE)
MBS6320099-01 0.2 mL

MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (PE)

Ask
View Details
MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (PE)
MBS6320099-02 5x 0.2 mL

MEF2A, ID (MEF2A, MEF2, Myocyte-specific enhancer factor 2A, Serum response factor-like protein 1) (PE)

Ask
View Details
Lentiviral mouse Akr1c14 shRNA (UAS) - Lentiviral mouse Akr1c14 shRNA (UAS, GFP) (100)
GTR15178917 1 Vial

Lentiviral mouse Akr1c14 shRNA (UAS) - Lentiviral mouse Akr1c14 shRNA (UAS, GFP) (100)

Ask
View Details
OsteoInductive Factor (OIF) discontinued
171707 20 µL

OsteoInductive Factor (OIF) discontinued

Ask
View Details
GIT1, phosphorylated (Tyr554) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1)
G2035-07P 200 µL

GIT1, phosphorylated (Tyr554) (ARF GTPase-activating protein GIT1, G protein-coupled receptor kinase-interactor 1, GRK-interacting protein 1, Cool-associated and tyrosine-phosphorylated protein 1, Cat-1, GIT1)

Ask
View Details