Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD79B Rabbit pAb (APR24560N)

Product Specifications

Background

The B lymphocyte antigen receptor is a multimeric complex that includes the antigen-specific component, surface immunoglobulin (Ig) . Surface Ig non-covalently associates with two other proteins, Ig-alpha and Ig-beta, which are necessary for expression and function of the B-cell antigen receptor. This gene encodes the Ig-beta protein of the B-cell antigen component. Alternatively spliced transcript variants encoding different isoforms have been described.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD79B Rabbit pAb (APR24560N) .

Synonyms

CD79B; AGM6; B29; IGB

Gene ID

974

UniProt

P40259

Cellular Locus

Cell membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/26kDa Observed MW: 36KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=974

Uniprot URL

https://www.uniprot.org/uniprot/P40259

AA Sequence

ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Carboxylesterase 1 (CES1) ELISA Kit
DLR-CES1-Ra-96T 96 Tests

Rat Carboxylesterase 1 (CES1) ELISA Kit

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2107295-01 0.1 mL

HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2107295-02 0.2 mL

HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2107295-03 0.5 mL

HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2107295-04 1 mL

HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details
HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)
MBS2107295-05 5 mL

HRP-Linked Monoclonal Antibody to Immunoglobulin G (IgG)

Sign In for Pricing
View Details