Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

[KO Validated] NT5E / CD73 Rabbit pAb (APR24557N)

Product Specifications

Background

The protein encoded by this gene is a plasma membrane protein that catalyzes the conversion of extracellular nucleotides to membrane-permeable nucleosides. The encoded protein is used as a determinant of lymphocyte differentiation. Defects in this gene can lead to the calcification of joints and arteries. Two transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality [KO Validated] NT5E / CD73 Rabbit pAb (APR24557N) .

Synonyms

NT5E; CALJA; CD73; E5NT; NT; NT5; NTE; eN; eNT

Gene ID

4907

UniProt

P21589

Cellular Locus

Cell membrane, GPI-anchor, Lipid-anchor

Applications

FC (Homo sapiens)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 57kDa/63kDa Observed MW: 70KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4907

Uniprot URL

https://www.uniprot.org/uniprot/P21589

AA Sequence

LKIEFDERGNVISSHGNPILLNSSIPEDPSIKADINKWRIKLDNYSTQELGKTIVYLDGSSQSCRFRECNMGNLICDAMINNNLRHTDEMFWNHVSMCILNGGGIRSPIDERNNGTITWENLAAVLPFGGTFDLVQLKGSTLKKAFEHSVHRYGQSTGEFLQVGGIHVVYDLSRKPGDRVVKLDVLCTKCRVPSYDPLKMDEVYKVILPNFLANGGDGFQMIKDELLRHDSGDQDINVVSTYISKMKVIYPAVEGRIKFST

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal TRPS1 Antibody (TRPS1/8008R) [Alexa Fluor 405]
NBP3-21052AF405 0.1 mL

Rabbit Monoclonal TRPS1 Antibody (TRPS1/8008R) [Alexa Fluor 405]

Sign In for Pricing
View Details
Human NXT2 activation kit by CRISPRa
GA111060 1 Kit

Human NXT2 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Mouse EFNA5 (C-6His)
PHM0593-01 10 µg

Recombinant Mouse EFNA5 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse EFNA5 (C-6His)
PHM0593-02 50 µg

Recombinant Mouse EFNA5 (C-6His)

Sign In for Pricing
View Details
Recombinant Mouse EFNA5 (C-6His)
PHM0593-03 500 µg

Recombinant Mouse EFNA5 (C-6His)

Sign In for Pricing
View Details
Rhodococcus equi PCR kit
PCR-V148-96D 100T

Rhodococcus equi PCR kit

Sign In for Pricing
View Details