Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27A Rabbit pAb (APR24555N)

Product Specifications

Background

Ubiquitin, a highly conserved protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome, is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein S27a at the C terminus. When expressed in yeast, the protein is post-translationally processed, generating free ubiquitin monomer and ribosomal protein S27a. Ribosomal protein S27a is a component of the 40S subunit of the ribosome and belongs to the S27AE family of ribosomal proteins. It contains C4-type zinc finger domains and is located in the cytoplasm. Pseudogenes derived from this gene are present in the genome. As with ribosomal protein S27a, ribosomal protein L40 is also synthesized as a fusion protein with ubiquitin; similarly, ribosomal protein S30 is synthesized as a fusion protein with the ubiquitin-like protein fubi. Multiple alternatively spliced transcript variants that encode the same proteins have been identified.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPS27A Rabbit pAb (APR24555N) .

Synonyms

RPS27A; CEP80; HEL112; S27A; UBA80; UBC; UBCEP1; UBCEP80

Gene ID

6233

UniProt

P62979

Cellular Locus

Cytoplasm, Nucleus

Applications

IF (Mus musculus) WB (Mus musculus)

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 17kDa Observed MW: 14kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6233

Uniprot URL

https://www.uniprot.org/uniprot/P62979

AA Sequence

MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDENGKISRLRRECPSDECGAGVFMASHFDRHYCGKCCLTYCFNKPEDK

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UGT2B17 (NM_001077) Human 3' UTR Clone
SC206242 10 µg

UGT2B17 (NM_001077) Human 3' UTR Clone

Ask
View Details
Human cardiotrophln 1 (CT-1) ELISA Kit
CK-bio-20618-01 48 Tests

Human cardiotrophln 1 (CT-1) ELISA Kit

Ask
View Details
Human cardiotrophln 1 (CT-1) ELISA Kit
CK-bio-20618-02 96 Tests

Human cardiotrophln 1 (CT-1) ELISA Kit

Ask
View Details
Human cardiotrophln 1 (CT-1) ELISA Kit
CK-bio-20618-03 5x 96 Tests

Human cardiotrophln 1 (CT-1) ELISA Kit

Ask
View Details
Human cardiotrophln 1 (CT-1) ELISA Kit
CK-bio-20618-04 10x 96 Tests

Human cardiotrophln 1 (CT-1) ELISA Kit

Ask
View Details
MKKS (BBS6, McKusick-Kaufman/Bardet-Biedl Syndromes Putative Chaperonin, Bardet-Biedl Syndrome 6 Protein) (FITC)
MBS6385503-01 0.1 mL

MKKS (BBS6, McKusick-Kaufman/Bardet-Biedl Syndromes Putative Chaperonin, Bardet-Biedl Syndrome 6 Protein) (FITC)

Ask
View Details