Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CKM Rabbit pAb (APR24552N)

Product Specifications

Background

The protein encoded by this gene is a cytoplasmic enzyme involved in energy homeostasis and is an important serum marker for myocardial infarction. The encoded protein reversibly catalyzes the transfer of phosphate between ATP and various phosphogens such as creatine phosphate. It acts as a homodimer in striated muscle as well as in other tissues, and as a heterodimer with a similar brain isozyme in heart. The encoded protein is a member of the ATP:guanido phosphotransferase protein family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CKM Rabbit pAb (APR24552N) .

Synonyms

CKM; CKMM; M-CK

Gene ID

1158

UniProt

P06732

Cellular Locus

Cytoplasm

Applications

WB (Mus musculus)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 43kDa Observed MW: 43KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=1158

Uniprot URL

https://www.uniprot.org/uniprot/P06732

AA Sequence

MPFGNTHNKFKLNYKPEEEYPDLSKHNNHMAKVLTLELYKKLRDKETPSGFTVDDVIQTGVDNPGHPFIMTVGCVAGDEESYEVFKELFDPIISDRHGGYKPTDKHKTDLNHENLKGGDDLDPNYVLSSRVRTGRSIKGYTLPPHCSRGERRAVEKLSVEALNSLTGEFKGKYYPLKSMTEKEQQQLIDDHFLFDKPVSPLLLASGMARDWPDARGIWHNDNKSFLVWVNEEDHLRVISMEKGGNMKEVFRRFCVGLQKIEEIFKKAGHPFMWNQHLGYVLTCPSNLGTGLRGGVHVKLAHLSKHPKFEEILTRLRLQKRGTGGVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSIDDMIPAQK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (MaxLight 650)
MBS6256368-01 0.1 mL

Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (MaxLight 650)

Sign In for Pricing
View Details
Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (MaxLight 650)
MBS6256368-02 5x 0.1 mL

Telomeric Repeat Binding Factor 1 (Telomeric Repeat Binding Factor (NIMA-interacting) 1, TERF1, TRBF1, TRF, TRF1, hTRF1-AS, t-TRF1, FLJ41416, NIMA-interacting Protein 2, PIN2, TTAGGG Repeat-binding Factor 1, Telomeric Protein Pin2/TRF1) (MaxLight 650)

Sign In for Pricing
View Details
LEPREL4 shRNA (m) Lentiviral Particles
sc-153240-V 200 µL

LEPREL4 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Annexin V, Recombinant, Human (ATTO 488) (Annexin A5, Endonexin II, Lipocortin V, Placental Anticoagulant Protein I, Calphobindin I, Vascular Anticoagulant-alpha)
044559 100 Tests

Annexin V, Recombinant, Human (ATTO 488) (Annexin A5, Endonexin II, Lipocortin V, Placental Anticoagulant Protein I, Calphobindin I, Vascular Anticoagulant-alpha)

Sign In for Pricing
View Details
Rabbit Monoclonal Mesp1 Antibody (2030B) [PE]
FAB9219P 0.1 mL

Rabbit Monoclonal Mesp1 Antibody (2030B) [PE]

Sign In for Pricing
View Details
Human DEFB118 activation kit by CRISPRa
GA114643 1 Kit

Human DEFB118 activation kit by CRISPRa

Sign In for Pricing
View Details