Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BAT3/BAG6 Rabbit pAb (APR24541N)

Product Specifications

Background

This gene was first characterized as part of a cluster of genes located within the human major histocompatibility complex class III region. This gene encodes a nuclear protein that is cleaved by caspase 3 and is implicated in the control of apoptosis. In addition, the protein forms a complex with E1A binding protein p300 and is required for the acetylation of p53 in response to DNA damage. Multiple transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality BAT3/BAG6 Rabbit pAb (APR24541N) .

Synonyms

BAG6; BAG-6; BAT3; D6S52E; G3

Gene ID

7917

UniProt

P46379

Cellular Locus

Cytoplasm, Nucleus, cytosol

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 96kDa/113kDa/118kDa/119kDa/122kDa Observed MW: 160kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=7917

Uniprot URL

https://www.uniprot.org/uniprot/P46379

AA Sequence

MEPNDSTSTAVEEPDSLEVLVKTLDSQTRTFIVGAQMNVKEFKEHIAASVSIPSEKQRLIYQGRVLQDDKKLQEYNVGGKVIHLVERAPPQTHLPSGASSGTGSASATHGGGSPPGTRGPGASVHDRNANSYVMVGTFNLPSDGSAVDVHINMEQAPIQSEPRVRLVMAQHMIRDIQTLLSRMECRGGPQPQHSQPPPQP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CELF1 AAV Vector (Rat) (CMV)
15853106 1 µg

CELF1 AAV Vector (Rat) (CMV)

Sign In for Pricing
View Details
VWA5B1 sgRNA CRISPR Lentivector (Human) (Target 2)
K2623603 1.0 µg DNA

VWA5B1 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
OOSP1 siRNA (Mouse)
MBS8230870-01 15 nmol

OOSP1 siRNA (Mouse)

Sign In for Pricing
View Details
OOSP1 siRNA (Mouse)
MBS8230870-02 30 nmol

OOSP1 siRNA (Mouse)

Sign In for Pricing
View Details
OOSP1 siRNA (Mouse)
MBS8230870-03 5x 30 nmol

OOSP1 siRNA (Mouse)

Sign In for Pricing
View Details
Galntl2 sgRNA CRISPR Lentivector set (Mouse)
K3488201 3x 1.0 µg

Galntl2 sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details