Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD244 Rabbit pAb (APR24528N)

Product Specifications

Background

This gene encodes a cell surface receptor expressed on natural killer (NK) cells (and some T cells) that mediate non-major histocompatibility complex (MHC) restricted killing. The interaction between NK-cell and target cells via this receptor is thought to modulate NK-cell cytolytic activity. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD244 Rabbit pAb (APR24528N) .

Synonyms

CD244; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4

Gene ID

51744

UniProt

Q9BZW8

Cellular Locus

Membrane, Single-pass type I membrane protein

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 30kDa/36kDa/41kDa Observed MW: 36kDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51744

Uniprot URL

https://www.uniprot.org/uniprot/Q9BZW8

AA Sequence

CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIKAAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSKLIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALKBH4 (NM_017621) Human Tagged ORF Clone Lentiviral Particle
RC202849L3V 200 µL

ALKBH4 (NM_017621) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FAM70A (TMEM255A) Human Over-expression Lysate
orb1341457 100 µg

FAM70A (TMEM255A) Human Over-expression Lysate

Sign In for Pricing
View Details
ProSAPiP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-11198R-BF594 100 µL

ProSAPiP1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
CHAF1A Antibody - C-terminal region : HRP (ARP73926_P050-HRP)
ARP73926_P050-HRP 100 µL

CHAF1A Antibody - C-terminal region : HRP (ARP73926_P050-HRP)

Sign In for Pricing
View Details
LCE6A Polyclonal Antibody
orb1418653 100 µL

LCE6A Polyclonal Antibody

Sign In for Pricing
View Details
Reagecon Beryllium Standard for ICP, ICP-MS 1000 μg/mL (1000 ppm) in 2-5% Nitric Acid (HNO3)
PBE2A2 100 mL

Reagecon Beryllium Standard for ICP, ICP-MS 1000 μg/mL (1000 ppm) in 2-5% Nitric Acid (HNO3)

Sign In for Pricing
View Details