Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INSIG2 Rabbit pAb (APR24527N)

Product Specifications

Background

The protein encoded by this gene is highly similar to the protein product encoded by gene INSIG1. Both INSIG1 protein and this protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality INSIG2 Rabbit pAb (APR24527N) .

Synonyms

INSIG2; INSIG-2

Gene ID

51141

UniProt

Q9Y5U4

Cellular Locus

Endoplasmic reticulum membrane, Multi-pass membrane protein

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 24kDa Observed MW: 30KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=51141

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y5U4

AA Sequence

QIQRNVTLFPPDVIASIFSSAWWVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINHASAKVDFDNNIQLSLTLAALSIGLWWTFDR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTHFSD CRISPRa sgRNA lentivector (set of three targets)(Mouse)
30892124 3x 1.0µg DNA

MTHFSD CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Lentiviral human ULK3 shRNA (UAS) - Lentiviral human ULK3 shRNA (UAS) plasmid
GTR15103003 1 Vial

Lentiviral human ULK3 shRNA (UAS) - Lentiviral human ULK3 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Interleukin 33 (IL33) CLIA Kit
MBS2001126-01 24 Strip Well

Human Interleukin 33 (IL33) CLIA Kit

Sign In for Pricing
View Details
Human Interleukin 33 (IL33) CLIA Kit
MBS2001126-02 48 Well

Human Interleukin 33 (IL33) CLIA Kit

Sign In for Pricing
View Details
Human Interleukin 33 (IL33) CLIA Kit
MBS2001126-03 96 Well

Human Interleukin 33 (IL33) CLIA Kit

Sign In for Pricing
View Details
Human Interleukin 33 (IL33) CLIA Kit
MBS2001126-04 5x 96 Well

Human Interleukin 33 (IL33) CLIA Kit

Sign In for Pricing
View Details