Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL5 Rabbit pAb (APR24515N)

Product Specifications

Background

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18P family of ribosomal proteins. It is located in the cytoplasm. The protein binds 5S rRNA to form a stable complex called the 5S ribonucleoprotein particle (RNP), which is necessary for the transport of nonribosome-associated cytoplasmic 5S rRNA to the nucleolus for assembly into ribosomes. The protein interacts specifically with the beta subunit of casein kinase II. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. This gene is co-transcribed with the small nucleolar RNA gene U21, which is located in its fifth intron. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Synonyms

RPL5; DBA6; L5; MSTP030; PPP1R135

Gene ID

6125

UniProt

P46777

Cellular Locus

Cytoplasm, Nucleus, nucleolus

Dilution

WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 34kDa Observed MW: 34KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality RPL5 Rabbit pAb (APR24515N) .

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=6125

Uniprot URL

https://www.uniprot.org/uniprot/P46777

AA Sequence

MGFVKVVKNKAYFKRYQVKFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIVRVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNY

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (HRP)
MBS6179362-01 0.1 mL

S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (HRP)

Ask
View Details
S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (HRP)
MBS6179362-02 5x 0.1 mL

S100A6 (S100 Calcium Binding Protein A6, 2A9, 5B10, CABP, CACY, PRA) (HRP)

Ask
View Details
rno-miR-3548 mimic
HY-R04384-01 5 nmol

rno-miR-3548 mimic

Ask
View Details
rno-miR-3548 mimic
HY-R04384-02 20 nmol

rno-miR-3548 mimic

Ask
View Details
OLR1590 Adenovirus (Rat)
34061056 1.0 ml

OLR1590 Adenovirus (Rat)

Ask
View Details
Bovine non-cancerous lung cells 1 ELISA Kit
MBS7217520-01 48 Well

Bovine non-cancerous lung cells 1 ELISA Kit

Ask
View Details